PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold05119-augustus-gene-0.16-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family MYB
Protein Properties Length: 223aa    MW: 25435.3 Da    PI: 5.9752
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold05119-augustus-gene-0.16-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.21.6e-071863346
                                                   SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
                                Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                                                   +W+   d+l+ +a+  ++ g   +W++Ia  +  g+++ +++ ++ +
  maker-scaffold05119-augustus-gene-0.16-mRNA-1 18 SWSRVQDKLFEEAIVVFPEGtqdRWEKIATQVL-GKSPLEVRRHYED 63
                                                   7*******************************9.***********76 PP

2Myb_DNA-binding48.91.5e-15115159347
                                                    SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                                Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                                    +WT+eE+ l++ + +q+G+g+W++I+r+  k Rt+ q+ s+ qky
  maker-scaffold05119-augustus-gene-0.16-mRNA-1 115 PWTEEEHRLFLYGLQQFGKGDWRSISRKAVKSRTPTQVASHAQKY 159
                                                    8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.1E-71567IPR001005SANT/Myb domain
SuperFamilySSF466893.51E-111772IPR009057Homeodomain-like
PROSITE profilePS500906.2721765IPR017877Myb-like domain
PfamPF002493.2E-61864IPR001005SANT/Myb domain
CDDcd001672.59E-42465No hitNo description
SuperFamilySSF466891.17E-17108165IPR009057Homeodomain-like
PROSITE profilePS5129417.253108164IPR017930Myb domain
TIGRFAMsTIGR015579.5E-17112163IPR006447Myb domain, plants
SMARTSM007176.1E-11112162IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-11114158IPR009057Homeodomain-like
CDDcd001675.00E-10115160No hitNo description
PfamPF002492.2E-11115159IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MSLTRNISNQ SSIGDSSSWS RVQDKLFEEA IVVFPEGTQD RWEKIATQVL GKSPLEVRRH  60
YEDLVHDLLE IDSGRVELPS YGDEFDSVGQ SSEYSEGPVD FGSKAKETQR RRGVPWTEEE  120
HRLFLYGLQQ FGKGDWRSIS RKAVKSRTPT QVASHAQKYF LRQNSVKKER KKCSIHDITT  180
VEEAANSVGL GQINDQIWEM GPAMPLCDHQ SLEEYNKGFG FSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A6e-151181373RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002523835.14e-84PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-50DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLB9SCW64e-84B9SCW6_RICCO; DNA binding protein, putative
STRINGGLYMA10G42450.14e-73(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.12e-68MYB family protein